PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462888511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 218aa    MW: 25359.9 Da    PI: 8.2446
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462888511genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox246.6e-081682012154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp+++++++L +++gL+ +q+ +WF N+R +
  462888511 168 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 201
                469*****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012563.2E-13254IPR005541KNOX2
PfamPF037914.1E-121553IPR005541KNOX2
PROSITE profilePS5007111.726142205IPR001356Homeobox domain
SMARTSM003891.8E-10144209IPR001356Homeobox domain
SuperFamilySSF466892.14E-16144208IPR009057Homeodomain-like
CDDcd000865.19E-11145206No hitNo description
Gene3DG3DSA:1.10.10.601.5E-25149208IPR009057Homeodomain-like
PfamPF059206.7E-18162201IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MPQQTPIPDA NRKAQYLMLL CSFREQLQQH VRVHAVEAVM ACREIEQSLQ DLTGATLEEG  60
TGATMSEDED EPPIMDGPMD MGSDAHDMMG FGPLLPTDSE RSLMERVRQE LKIELKQLIR  120
RSFPFSSLQG FKSRIEDVRE EILRKRRAGK LPGDTTSILK QWWQQHAKWP YPTEDDKAKL  180
VEETGLQLKQ INNWFINQRK RNWHNNSQTS TLKSKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A4e-13145201864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1198217RKRNWHNNSQTSTLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0693361e-119BT069336.2 Zea mays full-length cDNA clone ZM_BFc0110H11 mRNA, complete cds.
GenBankEU9669071e-119EU966907.1 Zea mays clone 298091 homeobox protein HD1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985913.11e-133PREDICTED: homeobox protein knotted-1-like 3
SwissprotQ94LW31e-132KNOS3_ORYSJ; Homeobox protein knotted-1-like 3
TrEMBLK4ACX01e-133K4ACX0_SETIT; Uncharacterized protein
STRINGSi036727m1e-133(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-104KNOTTED-like homeobox of Arabidopsis thaliana 7